Wikipedia

Dulaglut­id

Dulaglut­id
Ande­re Namen
  • Tru­li­ci­ty
  • LY2189265
Mas­se/Länge Pri­mär­struk­tur 59,67 kDa; GLP-1-Ami­no­säu­ren­se­quenz: HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG (Unter­schie­de gegen­über Wild­typ-GLP‑1 fett mar­kiert)[1]
Sekun­där- bis Quar­tär­struk­tur Sum­men­for­mel: C2646H4044N704O836S18
Bezeich­ner
Exter­ne IDs
Arz­nei­stoff­an­ga­ben
ATC-Code A10BJ05
Drug­Bank DB09045
Wirk­stoff­klas­se Anti­dia­be­ti­kum (Inkre­tin­mime­ti­kum, GLP‑1-Rezep­to­r­ago­nist)

Dulaglut­id (Han­dels­na­me Tru­li­ci­ty) ist ein Arz­nei­stoff aus der Grup­pe der Inkre­tin­mime­ti­ka. Es wird zur Behand­lung des Typ-2-Dia­be­tes ein­ge­setzt, um den Blut­zu­cker zu regu­lie­ren und dadurch Krank­heits­fol­gen wie Organ­schä­den zu ver­hin­dern. Dulaglut­id wird meist zusam­men mit wei­te­ren Anti­dia­be­ti­ka ein­ge­setzt. Es wird ein­mal wöchent­lich mit­tels Injek­ti­on in die Unter­haut (sub­ku­tan) ver­ab­reicht. Als Ago­nist des GLP‑1-Rezep­tors wirkt es durch den Inkre­tin-Effekt gegen einen zu hohen Blut­zu­cker. In der EU ist Dulaglut­id seit 2014 zur Behand­lung zuge­las­sen. Inha­ber der Zulas­sung ist die Fir­ma Lil­ly.[2][3][4][5][6]

Kli­ni­sche Anga­ben[Bear­bei­ten | Quell­text bear­bei­ten]

Anwen­dungs­ge­bie­te[Bear­bei­ten | Quell­text bear­bei­ten]

Dulaglut­id ist in der EU und der Schweiz mit Stand Juni 2022 ange­zeigt zur Behand­lung von Erwach­se­nen mit unzu­rei­chend kon­trol­lier­tem Typ-2-Dia­be­tes mel­li­tus ergän­zend zu Diät und Bewe­gung[2][4]:

  • als Mono­the­ra­pie bei Unver­träg­lich­keit oder Kon­tra­in­di­ka­tio­nen von Met­formin, oder
  • zusätz­lich zu ande­ren Anti­dia­be­ti­ka

Die Zulas­sung von Dulaglut­id in der EU erfolg­te im Jahr 2014 auf Grund­la­ge von fünf kli­ni­schen Stu­di­en zum Ver­gleich von Dulaglut­id, teils zusam­men mit ande­ren Anti­dia­be­ti­ka, gegen­über Pla­ce­bo, Met­formin, Sitag­lip­tin, Exe­na­tid oder Insu­lin glar­gin. In den Stu­di­en führ­te die Behand­lung mit Dulaglut­id und ggf. wei­te­ren Medi­ka­men­ten zu einer signi­fi­kant stär­ke­ren Sen­kung des Lang­zeit-Blut­zu­ckers (HbA1c-Wert) als die Ver­gleichs­be­hand­lun­gen. Über­wie­gend erreich­ten auch signi­fi­kant mehr Pati­en­ten die HbA1c-Ziel­wer­te von < 7,0 % und ≤ 6,5 %.[3]

Im Rah­men des deut­schen Dise­a­se-Manage­ment-Pro­gramms des Typ-2-Dia­be­tes sol­len Pati­en­ten mit einer kli­nisch rele­van­ten Neph­ro­pa­thie früh­zei­tig eine Kom­bi­na­ti­ons­the­ra­pie mit Met­formin und ent­we­der einem SGLT-2-Hem­mer oder einem GLP-1-Rezep­to­r­ago­nis­ten wie Dulaglut­id erhal­ten, wenn sie nach Abwä­gung der Wir­kun­gen und Neben­wir­kun­gen dazu bereit sind.[7]

Dulaglut­id wird durch die deut­sche Natio­na­le Ver­sor­gungs­leit­li­nie (NVL) zum Typ-2-Dia­be­tes als einer von meh­re­ren mög­li­chen Wirk­stof­fen zur Behand­lung bestimm­ter Pati­en­ten mit Typ-2-Dia­be­tes emp­foh­len[5]:

  • Bei Pati­en­ten einer kli­nisch rele­van­ten Herz-Kreis­lauf-Erkran­kung soll ein SGLT-2-Hem­mer oder ein GLP-1-Rezep­to­r­ago­nist wie Dulaglut­id, jeweils in Kom­bi­na­ti­on mit Met­formin, als Mit­tel der ers­ten Wahl (Erst­li­ni­en­the­ra­pie) ein­ge­setzt wer­den.
  • Bei Pati­en­ten mit hohem Risi­ko für Krank­heits­fol­gen wie z. B. eine Nie­ren­in­suf­fi­zi­enz soll die Ent­schei­dung über die Behand­lung mit einem die­ser Wirk­stof­fe oder mit Met­formin pati­en­ten­in­di­vi­du­ell und gemein­sam durch Arzt und Pati­ent getrof­fen wer­den.
  • Bei Pati­en­ten ohne hohes Risi­ko kommt Dulaglut­id als einer von meh­re­ren mög­li­chen Wirk­stof­fen als Mit­tel der zwei­ten Wahl infra­ge, wenn das indi­vi­du­el­le The­ra­pie­ziel des Pati­en­ten nach 3–6 Mona­ten einer Behand­lung mit Met­formin nicht erreicht wur­de.

Grund­la­ge für die Emp­feh­lung von Dulaglut­id als mög­li­che Behand­lungs­op­ti­on durch die Leit­li­nie sind die Ergeb­nis­se der kli­ni­schen Stu­die REWIND[8], in der Dulaglut­id mit einem Pla­ce­bo ver­gli­chen wur­de. Alle Pati­en­ten in die­ser Stu­die hat­ten einen Typ-2-Dia­be­tes mit erhöh­tem Herz-Kreis­lauf-Risi­ko und erhiel­ten zusätz­lich wei­te­re Anti­dia­be­ti­ka. Bei Behand­lung mit Dulaglut­id tra­ten weni­ger nicht-töd­li­che Schlag­an­fäl­le auf. Eben­so blieb die Nie­ren­funk­ti­on bes­ser erhal­ten, dies wur­de jedoch nur im Rah­men eines explo­ra­ti­ven End­punk­tes unter­sucht. In Bezug auf ande­re End­punk­te wur­den kei­ne kli­nisch rele­van­ten Unter­schie­de fest­ge­stellt, dar­un­ter nicht-töd­li­che Herz­in­fark­te, kar­dio­vas­ku­lä­rer Tod und Gesamt­mor­ta­li­tät. Als Neben­wir­kung trat unter Dulaglut­id gering­fü­gig sel­te­ner Unter­zu­cker auf, dafür kam es deut­lich häu­fi­ger zu Durch­fall, Übel­keit oder Erbre­chen. Die sel­te­nen, aber schwer­wie­gen­den Ereig­nis­se Pan­krea­ti­tis, Pan­kre­as­kar­zi­nom oder sons­ti­ge Krebs­er­kran­kung, die mög­li­cher­wei­se im Zusam­men­hang mit GLP-1-Rezep­to­r­ago­nis­ten auf­tre­ten, kamen in der Stu­die unter Dulaglut­id nicht häu­fi­ger vor als unter Pla­ce­bo.[5]

Im Rah­men der frü­hen Nut­zen­be­wer­tung wur­de Dulaglut­id bei Pati­en­ten in ver­schie­de­nen Behand­lungs­si­tua­tio­nen mit jeweils ver­schie­de­nen ande­ren Medi­ka­men­ten ver­gli­chen, wobei meist auch Liraglut­id eine mög­li­che Ver­gleichs­the­ra­pie war. Liraglut­id und Dulaglut­id gehö­ren bei­de zur Wirk­stoff­klas­se der Inkre­tin­mime­ti­ka. Ein Zusatz­nut­zen von Dulaglut­id wur­de für Pati­en­ten fest­ge­stellt, bei denen Diät und Bewe­gung sowie die Behand­lung mit Insu­lin den Blut­zu­cker nicht aus­rei­chend kon­trol­lie­ren. Für die­se Pati­en­ten stellt der Gemein­sa­me Bun­des­aus­schus­ses (G‑BA) auf Grund­la­ge der Ergeb­nis­se der Stu­di­en AWARD‑4[9] und AWARD‑7[10] einen Anhalts­punkt für einen gerin­gen Zusatz­nut­zen von Dulaglut­id im Ver­gleich zu einer opti­mier­ten Insu­lin­be­hand­lung fest. Grund dafür war, dass bei Behand­lung mit Dulaglut­id weni­ger schwe­re Neben­wir­kun­gen wie gefähr­li­cher Unter­zu­cker auf­tra­ten. Aller­dings bra­chen mehr Pati­en­ten die Behand­lung auf­grund von ande­ren Neben­wir­kun­gen wie Durch­fall, Übel­keit und Erbre­chen ab.[11]

Für Pati­en­ten in ande­ren Behand­lungs­si­tua­tio­nen, bei­spiels­wei­se wenn die Behand­lung mit ein oder zwei ande­ren blut­zu­cker­sen­ken­den Arz­nei­mit­teln (außer Insu­lin) den Blut­zu­cker nicht aus­rei­chend kon­trol­liert oder wenn Met­formin auf­grund einer Unver­träg­lich­keit nicht geeig­net ist, wur­de kein Zusatz­nut­zen von Dulaglut­id fest­ge­stellt. Dies lag meist dar­an, dass ein Ver­gleich nicht mög­lich war, da kei­ne bzw. kei­ne geeig­ne­ten Daten aus kli­ni­schen Stu­di­en vor­la­gen. So wur­de in der Stu­die REWIND[8] Dulaglut­id mit einem Pla­ce­bo ver­gli­chen, wobei alle Pati­en­ten gleich­zei­tig eine soge­nann­te Stan­dard­the­ra­pie mit ande­ren Anti­dia­be­ti­ka erhiel­ten. Im Rah­men die­ser Stan­dard­the­ra­pie wur­den jedoch die Wirk­stof­fe Liraglut­id und Empagli­flo­zin kaum ein­ge­setzt, obwohl dies durch medi­zi­ni­sche Leit­li­ni­en aus­drück­lich emp­foh­len wird. Dar­über hin­aus zeig­ten sich in der Stu­die nur gering­fü­gi­ge Vor­tei­le von Dulaglut­id. Daher wur­de anhand die­ser Stu­die kein Zusatz­nut­zen von Dulaglut­id abge­lei­tet.[11]

Art und Dau­er der Anwen­dung[Bear­bei­ten | Quell­text bear­bei­ten]

Dulaglut­id wird ein­mal wöchent­lich sub­ku­tan in Bauch, Ober­schen­kel oder Ober­arm inji­ziert; es darf nicht intra­ve­nös oder intra­mus­ku­lär ver­ab­reicht wer­den. Die Injek­ti­on kann zu jeder belie­bi­gen Tages­zeit unab­hän­gig von den Mahl­zei­ten statt­fin­den. Sie muss nicht durch einen Arzt erfol­gen, son­dern die Pati­en­ten kön­nen sich Dulaglut­id selbst inji­zie­ren oder von einer Betreu­ungs­per­son inji­zie­ren las­sen.[2]

Wenn das indi­vi­du­el­le The­ra­pie­ziel nach drei bis sechs Mona­ten nicht erreicht wur­de, sol­len gemäß NVL die The­ra­pie­stra­te­gie und das The­ra­pie­ziel gemein­sam von Arzt und Pati­ent über­prüft wer­den. Die The­ra­pie kann dann ent­we­der inten­si­viert wer­den, oder es kann ein zusätz­li­ches oder ande­res Medi­ka­ment ein­ge­setzt wer­den.[5]

Neben­wir­kun­gen[Bear­bei­ten | Quell­text bear­bei­ten]

Typi­sche und häu­fi­ge Neben­wir­kun­gen von Dulaglut­id und ande­ren GLP-1-Rezep­to­r­ago­nis­ten betref­fen den Ver­dau­ungs­trakt, meist in Form von Durch­fall, Übel­keit und Erbre­chen.[5] In den kli­ni­schen Stu­di­en zu Dulaglut­id waren die­se Neben­wir­kun­gen vor­über­ge­hend und meist leicht bis mäßig. Nach den Ergeb­nis­sen einer kli­ni­schen Stu­die zum Ver­gleich von Dulaglut­id in Mono­the­ra­pie mit Met­formin ist die Ver­träg­lich­keit der bei­den Wirk­stof­fe ver­gleich­bar. Unter­zu­cker und Übel­keit tra­ten in die­ser Stu­die ähn­lich häu­fig auf, Durch­fall sel­te­ner und Erbre­chen etwas häu­fi­ger.[2]

Bei mit Dulaglut­id behan­del­ten Pati­en­ten wur­de, vor allem zu Beginn der The­ra­pie, über Dehy­drie­rung berich­tet, die manch­mal zu aku­tem Nie­ren­ver­sa­gen oder einer Ver­schlech­te­rung der Nie­ren­funk­ti­on führ­te. Dies trat beson­ders bei sol­chen Pati­en­ten auf, die zuvor Übel­keit, Erbre­chen, Durch­fall oder eine Dehy­drie­rung zeig­ten. Die Pati­en­ten soll­ten daher gemäß Zulas­sung auf das mög­li­che Risi­ko einer Dehy­drie­rung und auf Maß­nah­men zum Ver­mei­den eines Flüs­sig­keits­man­gels hin­ge­wie­sen wer­den.[2]

Es wur­de eine Ver­bin­dung von GLP-1-Rezep­to­r­ago­nis­ten wie Dulaglut­id mit dem Risi­ko einer aku­ten Pan­krea­ti­tis fest­ge­stellt. In kli­ni­schen Stu­di­en wur­de das Auf­tre­ten einer aku­ten Pan­krea­ti­tis in Ver­bin­dung mit Dulaglut­id berich­tet.[5] Ein ursäch­li­cher Zusam­men­hang ist nicht erwie­sen. Eine aku­te Pan­krea­ti­tis trat in den kli­ni­schen Stu­di­en zu Dulaglut­id nicht häu­fi­ger auf als unter Pla­ce­bo. Den­noch sol­len gemäß Zulas­sung die Pati­en­ten über die typi­schen Sym­pto­me einer aku­ten Pan­krea­ti­tis infor­miert wer­den.[2]

Die Euro­päi­sche Arz­nei­mit­tel-Agen­tur (EMA) hat 2013 eine Unter­su­chung zur Bewer­tung der Sicher­heit von GLP-1-Rezep­to­r­ago­nis­ten in Auf­trag gege­ben. Anhand der Ergeb­nis­se die­ser Unter­su­chung wur­de kein Hin­weis auf ein erhöh­tes Risi­ko für Pan­kre­as­kar­zi­no­me fest­ge­stellt, aller­dings war die Ereig­nis­zahl für eine abschlie­ßen­de Bewer­tung zu gering.[5][12]

GLP-1-Rezep­to­r­ago­nis­ten wie Dulaglut­id kön­nen zu Gewichts­re­duk­ti­on füh­ren, was je nach Gewicht des jewei­li­gen Pati­en­ten eine erwünsch­te oder eine uner­wünsch­te Neben­wir­kung sein kann.[5]

Gegen­an­zei­gen[Bear­bei­ten | Quell­text bear­bei­ten]

Dulaglut­id darf nicht bei Pati­en­ten mit Typ-1-Dia­be­tes mel­li­tus oder zur Behand­lung einer dia­be­ti­schen Keto­azi­do­se ange­wen­det wer­den.[2]

Wech­sel­wir­kun­gen mit ande­ren Medi­ka­men­ten[Bear­bei­ten | Quell­text bear­bei­ten]

Dulaglut­id ver­zö­gert die Magen­ent­lee­rung und könn­te daher poten­ti­ell die Absorp­ti­on ora­ler Begleit­me­di­ka­ti­on ver­zö­gern. In kli­ni­schen Stu­di­en wur­de aller­dings kein rele­van­ter dem­entspre­chen­der Effekt fest­ge­stellt.[2]

Wenn Dulaglut­id zusam­men mit dem DPP4-Hem­mer Sitag­lip­tin ein­ge­nom­men wird, erhöht sich die Bio­ver­füg­bar­keit von Dulaglut­id, was des­sen Wir­kung auf den Blut­zu­cker­spie­gel stei­gern kann.[2]

Pati­en­ten, die Dulaglut­id in Kom­bi­na­ti­on mit einem Sul­fo­nyl­harn­stoff oder einem Insu­lin erhal­ten, kön­nen ein erhöh­tes Risi­ko für Unter­zu­cker haben. Die­ses Risi­ko kann durch eine Dosis­re­duk­ti­on des Sul­fo­nyl­harn­stoffs oder des Insu­lins ver­rin­gert wer­den.[2]

Bei Gabe von Dulaglut­id zusam­men mit Met­formin, Ator­vas­ta­tin, Digoxin, Lisi­no­pril, Meto­pro­lol, Par­acet­amol, War­fa­rin oder ora­len Ver­hü­tungs­mit­teln änder­te sich deren maxi­ma­ler Plas­ma­spie­gel (Cmax), jedoch nicht in einem kli­nisch rele­van­ten Maße.[2]

Anwen­dung wäh­rend Schwan­ger­schaft und Still­zeit[Bear­bei­ten | Quell­text bear­bei­ten]

Wäh­rend der Schwan­ger­schaft wird die Anwen­dung von Dulaglut­id gemäß Zulas­sung nicht emp­foh­len, da tier­ex­pe­ri­men­tel­le Stu­di­en eine Repro­duk­ti­ons­to­xi­zi­tät gezeigt haben.[2]

Wäh­rend der Still­zeit soll Dulaglut­id gemäß Zulas­sung nicht ange­wen­det wer­den.[2]

Aus­wir­kun­gen von Dulaglut­id auf die Frucht­bar­keit sind nicht bekannt. In Tier­ver­su­chen mit Rat­ten wur­de kei­ne direk­te Wir­kung auf die Frucht­bar­keit beob­ach­tet.[2]

Beson­de­re Pati­en­ten­grup­pen[Bear­bei­ten | Quell­text bear­bei­ten]

Bei Pati­en­ten mit Typ-1-Dia­be­tes mel­li­tus darf Dulaglut­id nicht ange­wen­det wer­den.[2]

Bei Pati­en­ten mit schwe­ren gas­tro­in­testi­na­len Erkran­kun­gen wur­de Dulaglut­id nicht unter­sucht und wird daher bei die­sen Pati­en­ten gemäß Zulas­sung nicht emp­foh­len.[2]

Bei Pati­en­ten mit einer ter­mi­na­len Nie­ren­in­suf­fi­zi­enz wird die Anwen­dung gemäß Zulas­sung nicht emp­foh­len, da es mit sol­chen Pati­en­ten nur sehr begrenz­te Erfah­run­gen gibt.[2]

Phar­ma­ko­lo­gi­sche Eigen­schaf­ten[Bear­bei­ten | Quell­text bear­bei­ten]

Auf­bau und Struk­tur[Bear­bei­ten | Quell­text bear­bei­ten]

Dulaglut­id ist ein rekom­bi­nan­tes Fusi­ons­pro­te­in, das in CHO-Zel­len pro­du­ziert wird. Es besteht aus zwei modi­fi­zier­ten huma­nen GLP-1-Pep­ti­den, die jeweils durch eine C‑terminale Pep­tid­brü­cke (Lin­ker) mit dem Fc-Abschnitt eines modi­fi­zier­ten huma­nen IgG4-Anti­kör­pers ver­bun­den sind. Die Modi­fi­ka­ti­on der GLP-1-Pep­ti­de besteht in drei Ami­no­säu­re­aus­tau­schen (A8G, G22E und R36G), wel­che die Spal­tung der Pep­ti­de durch die Dipep­ti­dyl­pep­ti­da­se 4 (DPP‑4) ver­hin­dern.[3][13][1]

Dies ver­län­gert die Halb­wert­zeit von Dulaglut­id deut­lich gegen­über kör­per­ei­ge­nem GLP‑1, das eine Halb­wert­zeit von 1,5–2 Minu­ten hat, auf etwa 4,7 Tage. Die Modi­fi­ka­ti­on des Fc-Abschnitts soll eine Fc-Rezep­tor-beding­te Immun­ant­wort ver­hin­dern und dadurch das immu­no­ge­ne Poten­ti­al von Dulaglut­id sen­ken.[2] Die Bin­dung der GLP-1-Pep­ti­de an den Fc-Abschnitt ver­lang­samt zudem deren Aus­schei­dung durch die Nie­re.[13]

Wir­kungs­me­cha­nis­mus[Bear­bei­ten | Quell­text bear­bei­ten]

GLP-1-Rezep­to­r­ago­nis­ten wie Dulaglut­id ahmen die Wir­kung des kör­per­ei­ge­nen Hor­mons GLP‑1 (Glu­ca­gon-like Pep­ti­de 1) nach, wel­ches durch den Inkre­tin-Effekt die glu­ko­se­ab­hän­gi­ge Frei­set­zung von Insu­lin aus den Beta­zel­len der Bauch­spei­chel­drü­se (Pan­kre­as) sti­mu­liert und die Glu­ca­gon-Aus­schüt­tung unter­drückt. GLP‑1 bewirkt dar­über hin­aus eine Ver­zö­ge­rung der Magen­ent­lee­rung und eine Appe­tit­hem­mung, was zur Gewichts­ab­nah­me bei­trägt.[5][2] Als Appe­tit­hem­mer ist Dulaglut­id jedoch gegen­wär­tig nicht zuge­las­sen.[2]

Auf­nah­me und Ver­tei­lung im Kör­per[Bear­bei­ten | Quell­text bear­bei­ten]

Die Eli­mi­na­ti­ons­halb­werts­zeit beträgt 4,7 Tage. Der maxi­ma­le Plas­ma­spie­gel (Cmax) wird nach etwa 48 Stun­den erreicht.[2]

Web­links[Bear­bei­ten | Quell­text bear­bei­ten]

Ein­zel­nach­wei­se[Bear­bei­ten | Quell­text bear­bei­ten]

  1. a b Signe V. Naver, Espen Jime­nez-Solem, Mik­kel Chris­ten­sen et al.: Dulaglut­ide: a novel once-weekly glu­ca­gon-like peptide‑1 recep­tor ago­nist. In: Clin Inves­tig (Lond). Band 4, Nr. 8, 2014, S. 729–743, doi:10.4155/CLI.14.65 (openaccessjournals.com [PDF; 700 kB; abge­ru­fen am 23. Juni 2022]). 
  2. a b c d e f g h i j k l m n o p q r s t u Tru­li­ci­ty: Zusam­men­fas­sung der Merk­ma­le des Arz­nei­mit­tels. (PDF; 3,0 MB) Euro­päi­sche Arz­nei­mit­tel-Agen­tur (EMA), 5. Juli 2021, abge­ru­fen am 20. Juni 2022. 
  3. a b c Tru­li­ci­ty: Euro­pean Public Assess­ment Report (EPAR). Euro­päi­sche Arz­nei­mit­tel-Agen­tur (EMA), 5. Juli 2021, abge­ru­fen am 20. Juni 2022. 
  4. a b Fach­in­for­ma­ti­on Tru­li­ci­ty® Fer­tig­pen. Swiss­me­dic, Sep­tem­ber 2021, abge­ru­fen am 20. Juni 2022. 
  5. a b c d e f g h i Natio­na­le Ver­sor­gungs­Leit­li­nie (NVL) Typ-2-Dia­be­tes, 2. Auf­la­ge, Ver­si­on 1. Bun­des­ärz­te­kam­mer (BÄK), Kas­sen­ärzt­li­che Bun­des­ver­ei­ni­gung (KBV), Arbeits­ge­mein­schaft der Wis­sen­schaft­li­chen Medi­zi­ni­schen Fach­ge­sell­schaf­ten (AWMF), 25. März 2021, abge­ru­fen am 20. Juni 2022. 
  6. Drugs@FDA: Tru­li­ci­ty. Food and Drug Admi­nis­tra­ti­on (FDA), 10. Juni 2022, abge­ru­fen am 20. Juni 2022. 
  7. DMP-Anfor­de­run­gen-Richt­li­nie: Ände­rung der Anla­ge 1 (DMP Dia­be­tes mel­li­tus Typ 2), der Anla­ge 2 (Indi­ka­ti­ons­über­grei­fen­de Doku­men­ta­ti­on (aus­ge­nom­men Brust­krebs)) und der Anla­ge 8 (Dia­be­tes mel­li­tus Typ 1 und Typ 2 – Doku­men­ta­ti­on). Gemein­sa­mer Bun­des­aus­schuss (G‑BA), 16. Juni 2022, abge­ru­fen am 23. Juni 2022. 
  8. a b Kli­ni­sche Stu­die (Pha­se 3): Rese­ar­ching Car­dio­vas­cu­lar Events With a Weekly Incre­tin in Dia­be­tes (REWIND) bei Clinicaltrials.gov der NIH
  9. Kli­ni­sche Stu­die (Pha­se 3): A Stu­dy in Par­ti­ci­pan­ts With Type 2 Dia­be­tes Mel­li­tus (AWARD‑4) bei Clinicaltrials.gov der NIH
  10. Kli­ni­sche Stu­die (Pha­se 3): A Stu­dy Com­pa­ring Dulaglut­ide With Insu­lin Glar­gi­ne on Gly­ce­mic Con­trol in Par­ti­ci­pan­ts With Type 2 Dia­be­tes (T2D) and Mode­ra­te or Seve­re Chro­nic Kid­ney Dise­a­se (CKD) (AWARD‑7) bei Clinicaltrials.gov der NIH
  11. a b Nut­zen­be­wer­tungs­ver­fah­ren zum Wirk­stoff Dulaglut­id (Erneu­te Nut­zen­be­wer­tung §13: Dia­be­tes mel­li­tus Typ 2). Gemein­sa­mer Bun­des­aus­schuss (G‑BA), 16. Juli 2020, abge­ru­fen am 21. Juni 2022. 
  12. Assess­ment report for GLP‑1 based the­ra­pies. EMA/474117/2013. (PDF; 0,3 MB) Euro­pean Medi­ci­nes Agen­cy (EMA), 25. Juli 2013, abge­ru­fen am 23. Juni 2022. 
  13. a b Juris J. Mei­er: GLP‑1 recep­tor ago­nists for indi­vi­dua­li­zed tre­at­ment of type 2 dia­be­tes mel­li­tus. In: Nat Rev Endo­cri­nol. Band 8, Nr. 12, Dezem­ber 2012, S. 728–42, doi:10.1038/nrendo.2012.140, PMID 22945360. 
source: https://de.wikipedia.org/wiki/Dulaglutid

(Wiki­pe­dia) Dulaglut­id (Han­dels­na­me Tru­li­ci­ty) ist ein Arz­nei­stoff aus der Grup­pe der Inkre­tin­mime­ti­ka. Es wird zur Behand­lung des Typ-2-Dia­be­tes ein­ge­setzt, um den Blut­zu­cker zu regu­lie­ren und dadurch Krank­heits­fol­gen wie Organ­schä­den zu ver­hin­dern. Dulaglut­id wird meist zusam­men mit wei­te­ren Anti­dia­be­ti­ka ein­ge­setzt. Es wird ein­mal wöchent­lich mit­tels Injek­ti­on in die Unter­haut (sub­ku­tan) ver­ab­reicht. Als Ago­nist des GLP-1-Rezep­tors wirkt es durch den Inkre­tin-Effekt gegen einen zu hohen Blut­zu­cker. In der EU ist Dulaglut­id seit 2014 zur Behand­lung zuge­las­sen.
Die­ser Text basiert auf dem Arti­kel Dulaglut­id aus der frei­en Enzy­klo­pä­die Wiki­pe­dia und steht unter der Lizenz Crea­ti­ve Com­mons CC-BY-SA 3.0 Unpor­ted (Kurz­fas­sung). In der Wiki­pe­dia ist eine Lis­te der Autoren ver­füg­bar.